PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AS_067BEC7B5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 207aa    MW: 22397.7 Da    PI: 8.6937
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AS_067BEC7B5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB143.93.7e-4522116195
                  NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 
                            vreqdr++Pianv+rim+++lPa+akis++ake +qecvsefisf t+ea+++c+ ++rkt+n++d++wal  lGf+dyv pl+v+l+
  Traes_7AS_067BEC7B5.1  22 VREQDRLMPIANVIRIMRRALPAHAKISDEAKEAIQECVSEFISFDTGEANERCRMQRRKTVNAEDIVWALNRLGFDDYVVPLSVFLE 109
                            69************************************************************************************** PP

                  NF-YB  89 kyreleg 95 
                            + r+ e+
  Traes_7AS_067BEC7B5.1 110 RMRDPEA 116
                            ***9775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-4218118IPR009072Histone-fold
SuperFamilySSF471131.77E-3225131IPR009072Histone-fold
PfamPF008082.4E-222992IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.7E-135674No hitNo description
PRINTSPR006159.7E-137593No hitNo description
PRINTSPR006159.7E-1394112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MENDGVPNGP AGPAPTQATP VVREQDRLMP IANVIRIMRR ALPAHAKISD EAKEAIQECV  60
SEFISFDTGE ANERCRMQRR KTVNAEDIVW ALNRLGFDDY VVPLSVFLER MRDPEAGTGG  120
AAAGYSRAVM SAPPRAASPV IHAVPLQAQR PMYATPAPVQ VHNQMQRPVY APPAPLQVQM  180
QQGIYGPRAP VHGYAVGMAP VRANVGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-3522113293NF-YB
4awl_B2e-3522113394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-3522113394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B1e-3522113192Transcription factor HapC (Eurofung)
4g92_B1e-3522113192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9027900.0GU902790.1 Triticum monococcum nuclear transcription factor Y subunit B9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452627.12e-51hypothetical protein SORBIDRAFT_04g029350
SwissprotQ84W663e-48NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLW5HCE41e-149W5HCE4_WHEAT; Uncharacterized protein
STRINGSb04g029350.15e-51(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-49nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]